ИМ. Академиков м. М. Шемякина и ю. А. Овчинникова icon

ИМ. Академиков м. М. Шемякина и ю. А. Овчинникова


Смотрите также:
М. М. Шемякина и Ю. А. Овчинникова ран...
«биотехнология: состояние и перспективы развития»...
«биотехнология: состояние и перспективы развития»...
М. М. Шемякина и Ю. А. Овчинникова ран...
М. М. Шемякина и Ю. А. Овчинникова ран...
М. М. Шемякина и Ю. А. Овчинникова ран...
М. М. Шемякина и Ю. А. Овчинникова ран...
Конкурс будет проводиться в двух возрастных категориях: школьники, студенты, аспиранты...
В. М. Липкин, Т. В. Овчинникова международная научная конференция по биоорганической химии...
В. Т. Иванов, директор Института биоорганической химии им. М. М. Шемякина и Ю. А...
Программа пятого съезда Общества биотехнологов России им. Ю. А...
М. М. Шемякина и Ю. А. Овчинникова ран «Процессинг аутоантигенов...



Загрузка...
страницы:   1   2   3   4
скачать


УЧРЕЖДЕНИЕ РОССИЙСКОЙ АКАДЕМИИ НАУК

ИНСТИТУТ БИООРГАНИЧЕСКОЙ ХИМИИ

ИМ. АКАДЕМИКОВ М.М. ШЕМЯКИНА И Ю.А. ОВЧИННИКОВА


На правах рукописи


ОВЧИННИКОВА Татьяна Владимировна


Структурно-функциональное исследование

природных пептидных антибиотиков


03.01.06 – Биотехнология (в том числе бионанотехнологии)

02.00.10 – Биоорганическая химия


Диссертация

в виде научного доклада

на соискание ученой степени доктора химических наук


Москва – 2011


Официальные оппоненты: академик РАН и РАМН,

доктор биологических наук,

профессор Ткачук Всеволод Арсеньевич


член-корреспондент РАН,

доктор химических наук,

профессор Кочетков Сергей Николаевич


член-корреспондент РАН,

доктор химических наук,

профессор Северин Евгений Сергеевич


Ведущая организация: Учреждение Российской академии наук

Институт биохимии им. А.Н. Баха РАН


Защита состоится «___» ___________ 2011 г. в ___ час. на заседании Совета по защите докторских диссертаций Д 212.120.01 Государственного образовательного учреждения высшего профессионального образования «Московская государственная академия тонкой химической технологии имени М.В.Ломоносова» (МИТХТ им. М.В.Ломоносова) по адресу: 119571 Москва, проспект Вернадского, 86.


С диссертацией в виде научного доклада можно ознакомиться в библиотеке Государственного образовательного учреждения высшего профессионального образования «Московская государственная академия тонкой химической технологии имени М.В.Ломоносова» (МИТХТ им. М.В.Ломоносова).


Диссертация в виде научного доклада разослана «___» ___________ 2011 г.


Учёный секретарь

диссертационного совета

к.х.н. А.И.Лютик


^ ОБЩАЯ ХАРАКТЕРИСТИКА РАБОТЫ


Актуальность исследования.

Cтремительный рост бактериальных инфекций, резистентных к антибиотикам, диктует насущную необходимость создания новых терапевтических антибактериальных агентов. В ряде случаев антибиотики из имеющегося арсенала лекарственных средств уже не обеспечивают эффективного контроля над возбудителем при развитии хронических и рецидивирующих инфекционных заболеваний. Ряд штаммов Mycobacterium tuberculosis, Enterococcus faecium и Pseudomonas aeroginosa все труднее подавляются конвенциальными антибиотиками. Возрастающая резистентность наблюдается также в отношение таких распространенных патогенов человека, как Staphylococcus aureus и Staphylococcus pneumoniae. Открытие пептидных антибиотиков и изучение их биологических функций показывает, что эти природные соединения являются перспективными молекулами для создания новых антимикробных средств.

В процессе эволюции многоклеточные организмы выработали эффективные механизмы защиты от патогенов. Лимфоцитарный иммунитет возник лишь с появлением челюстных рыб и существует менее чем у 2% видов многоклеточных организмов. Однако в первые часы взаимодействия с патогеном даже те животные, которые обладают способностью вырабатывать антитела, могут полагаться только на защитные механизмы системы врожденного иммунитета. Эндрогенные антимикробные пептиды (далее АМП) являются неотъемлемыми молекулярными факторами системы врожденного иммунитета организмов, обеспечивающими их выживание в окружении потенциальных патогенов (бактерий, грибков, простейших, вирусов). Результаты исследований структурного разнообразия и распространения АМП в природе дают основание полагать, что каждый биологический вид вырабатывает свой уникальный набор защитных пептидов, позволяющий ему успешно бороться с окружающей его патогенной микрофлорой. В настоящее время определены структуры около тысячи природных пептидных антибиотиков, выделенных из различных тканей беспозвоночных и позвоночных животных, растений, грибов, бактерий и обладающих способностью инактивировать широкий спектр микроорганизмов. Поиск и исследование новых АМП позволяет лучше понять закономерности функционирования врожденного иммунитета у человека. По мере углубления наших знаний о пептидных антибиотиках появляется все больше сведений об их участии в процессах регуляции иммунитета и регенерации тканей.

Наряду с фундаментальными исследованиями структурно-функциональных свойств АМП важное прикладное значение имеют работы по созданию эффективных лекарственных средств на их основе. Природные пептиды могут стать прототипами новых антибиотиков широкого спектра действия, способных решить проблему резистентности к существующим антимикробным средствам. Подавляющее большинство АМП относятся к мембранотропным антибиотикам, поэтому развитие резистентности патогенов к ним менее вероятно из-за низкоизбирательного механизма их действия и возможно только при существенных изменениях структуры и свойств клеточной мембраны. Кроме того, многие АМП усиливают действие традиционных антибиотиков. Известно, что длительная антибиотикотерапия в ряде случаев вызывает состояние иммунодефицита и эндотоксемию, однако многие АМП наряду с антибиотической обладают иммуномодулирующей и эндотоксин-нейтрализующей активностью. Все это создаёт предпосылки для создания новых эффективных антибиотических лекарственных средств на основе природных пептидных антибиотиков, лишенных перечисленных выше недостатков. Учитывая наличие выраженной антибиотической и иммуномодулирующей активности у природных АМП, многие зарубежные фармацевтические компании уже приступили к созданию нового класса антибиотиков на их основе, а первые из них уже проходят клинические испытания. Структурно-функциональные исследования природных пептидных антибиотиков могут внести существенный вклад в развитие этого перспективного направления медико-биологической науки, а разработка способов их получения с целью создания на их основе лекарственных средств нового поколения является одной из актуальных задач современной биотехнологии.

Диссертация выполнялась по разделам основных направлений научных исследований ИБХ РАН «Структура и функции белков и пептидов” и „Биотехнология”, утвержденных Ученым Советом ИБХ РАН. Работа проводилась при поддержке РФФИ; ФЦП «Научные и научно-педагогические кадры инновационной России» на 2009-2013 годы; ФЦП «Исследования и разработки по приоритетным направлениям развития научно-технологического комплекса России на 2007-2012 годы»; ФЦП «Национальная технологическая база» на 2007-2011 годы; целевой программы Президиума РАН «Фундаментальные науки – медицине».


^ Цель и задачи исследования.

Цель данной диссертационной работы состоит в исследовании структуры, биологических свойств и молекулярных механизмов действия природных эндогенных пептидных антибиотиков, а также в разработке биотехнологических способов их получения. Объектами исследования являются антимикробные пептиды ареницины из целомоцитов морского червя Arenicola marina [тип – кольчатые черви (Annelida), класс – многощетинковые (Polychaeta)]; аурелин из мезоглеи сцифоидной медузы Aurelia aurita [тип – кишечнополостные (Cnidaria), класс – сцифоидные (Scyphozoa)]; буфорин из желудка азиатской жабы Bufo bufo gargarizans [тип – хордовые (Chordata), класс – земноводные (Amphibia), отряд – земноводные бесхвостые (Anura), семейство – жабы настоящие (Bufonidae)]; дефенсин и липид-траспортирующий белок из чечевицы обыкновенной Lens culinaris [отдел – покрытосеменные (Magnoliophyta), класс – двудольные (Dicotyledones), порядок – бобовоцветные (Fabales), семейство – бобовые (Fabaceae), подсемейство - мотыльковые (Faboideae)]; зервамицин и антиамебин из мицелиальных спорообразующих грибов Emericellopsis salmocynnemata и Emericellopsis minima [отдел – настоящие грибы (Eumycota), подотдел – аскомицеты (Ascomycotina), класс - эуаскомицеты (Euascomycetes)]; латероцидин и латероцин из аэробной грам-положительной бактерии Brevibасillus laterosporus; лихеницидин из термофильной грам-положительной бактерии Bacillus licheniformis. В соответствии с поставленной целью были сформулированы следующие задачи:

1. Изучить структуру и свойства антимикробных пептидов ареницинов, аурелина, дефенсина и липид-транспортирующих белков чечевицы, зервамицина, антиамебина, латероцидина, латероцина, лихеницинов.

2. Разработать биотехнологические способы получения ареницинов, аурелина, буфорина, дефенсина и липид-транспортирующего белка чечевицы в искусственных экспрессирующих системах, включая методики их выделения и очистки.


^ Научная новизна работы.

Все результаты, изложенные в настоящей работе, получены впервые.

1. Впервые установлена структура новых антимикробных пептидов ареницинов из целомоцитов морского кольчатого червя ^ Arenicola marina, нового антимикробного пептида аурелина из мезоглеи сцифоидной медузы Aurelia aurita, нового дефенсина и новых липид-траспортирующих белков из семян чечевицы Lens culinaris, новых антимикробных пептидов латероцидина и латероцина из штаммов аэробных грам-положительных бактерий Brevibасillus laterosporus, новой двухкомпонентной системы лантибиотиков из термофильных грам-положительных бактерий Bacillus lichenifromis. Впервые определены полные нуклеотидные последовательности кДНК, кодирующих белки-предшественники ареницинов, аурелина, дефенсина и липид-траспортирующих белков чечевицы, лихеницидина и соответствующие им полные аминокислотные последовательности белков-предшественников.

2. Впервые сконструированы биотехнологические системы для гетерологичной экспрессии ареницина, аурелина, буфорина, дефенсина и липид-транспортирующего белка чечевицы. Впервые получены штамм-продуценты, позволяющие экспрессировать гибридные белки, содержащие искомые антимикробные пептиды. Впервые разработаны способы получения, методики выделения и очистки рекомбинантных ареницина, аурелина, буфорина, дефенсина и липид-транспортирующего белка чечевицы, полностью идентичных природным пептидным антибиотикам по молекулярной массе, аминокислотной последовательности и антимикробной активности.

3. Впервые разработаны биотехнологические способы получения аналогов ареницина, аурелина, зервамицина, антиамебина, дефенсина и липид-транспортирующего белка чечевицы, меченных стабильными изотопами.

4. Впервые проанализированы структурные особенности выделенных антимикробных пептидов и спектр их биологического действия в сравнении с другими представителями этого класса биологически активных веществ. Впервые изучены физико-химические свойства рекомбинантных ареницина, аурелина, дефенсина чечевицы, а также зервамицина, антиамебина и лихеницидина. С использованием полученных данных, предложены модели, описывающие механизмы антимикробной активности ряда исследованных пептидных антибиотиков.

Полученные сведения обогащают наши знания о защитных пептидах как природных молекулярных факторах врожденного иммунитета и могут стать основой для дальнейших исследований механизмов биологической активности этих веществ, а также могут представлять ценность для исследований в области молекулярной эволюции АМП.


^ Практическая ценность работы.

Полученные в ходе выполнения данной работы АМП могут представлять большой практический интерес в качестве антибиотиков нового типа. По своей антимикробной активности ряд полученных пептидов не уступают лучшим мировым аналогам. Широкому применению АМП в клинической практике препятствует высокая себестоимость их производства. Проблема может быть успешно решена методами биотехнологии, применение которых является значительно более экономически оправданным по сравнению с химическим синтезом. Полученные в ходе данной работы новые АМП могут быть также использованы для решения задач сельскохозяйственной биотехнологии по повышению устойчивости растительных культур по отношению к микробным, в особенности грибковым патогенам.


^ Апробация работы

Результаты исследований были представлены на IV, VI и VIII Гордоновских международных конференциях по антимикробным пептидам (Gordon Research Conferences “Antimicrobial peptides”, Барга, Италия, 2003, 2007, 2011), 33-м и 36-м Конгрессах ФЕБО (Афины, Греция, 2008 и Турин, Италия, 2011), XVIII Международном конгрессе по биохимии и молекулярной биологии (Бирмингем, Великобритания, 2000), Международной конференции “Peptaibols: Biosynthesis, Structural Diversity and Mode of Action” (Йена, Германия, 2002), Международных конференциях по магнитному резонансу “EUROMAR-2009” и “EUROMAR-2010” (Гётеборг, Швеция, 2009 и Флоренция, Италия, 2010), Международном симпозиуме «Nuclear magnetic resonance in condensed matter. The 4th meeting «NMR in life sciences» (Санкт-Петербург, 2007), российско-шведской конференции “NMR in Protein-Protein and Protein-DNA Recognition” (Москва, 2000), XI и XII международных конференциях “New information technology in medicine, biology, pharmacology, and ecology” (Гурзуф, Украина, 2003, 2004), IV, V и VI Московских международных конгрессах "Биотехнология: состояние и перспективы развития» (Москва, 2007, 2009, 2011), Международной конференции по биоорганической химии, биотехнологии и бионанотехнологии, посвященной 75-летию со дня рождения академика Ю.А.Овчинникова (Москва, 2009), Международной научно-практической конференции «Биотехнология. Вода и пищевые продукты» (Москва, 2008), Международной конференции «Scenarios for a coordinated approach to sustainable cooperation with the Eastern neighbors of the EU” (Москва, 2007), Международной конференции по физико-химической биологии, посвященной 70-летию со дня рождения академика Ю.А.Овчинникова (Москва, 2004), Международной конференции «Фармацевическая биоэтика» (Москва, 1997), рабочих совещаниях участников международного проекта INTAS (Санкт-Петербург, 2005; Триест, Италия, 2006), симпозиуме «Результаты фундаментальных и прикладных исследований для создания новых лекарственных средств» (Москва, 2008), III съезде Биохимического общества России (Санкт-Петербург, 2002), III съезде Общества биотехнологов России (Москва, 2005), Объединенном иммунологическом форуме (Екатеринбург, 2004), III Российском симпозиуме «Белки и пептиды» (Пущино, 2007), итоговых конференциях по результатам выполнения мероприятий в рамках приоритетного направления «Живые системы» ФЦП «Исследования и разработки по приоритетным направлениям развития научно-технологического комплекса России на 2007-2012 годы» (Москва, 2007, 2008, 2009), VIII чтениях, посвященных памяти академика Ю.А. Овчинникова (Москва, 2006), 50-й научной конференции МФТИ (Москва-Долгопрудный, 2007), научных конференциях ФИБХ РАН (Пущино, 1999, 2004), школе-конференции «Горизонты физико-химической биологии» (Пущино, 2000), XV-XXIII зимних молодежных научных школах «Перспективные направления физико-химической биологии и биотехнологии» (Москва, 2003-2011).


^ Публикации и патенты

По теме диссертации опубликовано 139 работ, в том числе 46 статей в ведущих отечественных и зарубежных рецензируемых журналах, из них 15 статей в российских журналах (Биоорганическая химия, Биотехнология, Биохимия, Доклады Академии наук и др.), 28 статей в зарубежных журналах (Anal. Bioanal. Chem., Appl. Magn. Res., BBA, Biochem. Biophys. Res. Commun., Biochemistry (USA), Bioorganic Chemistry (USA), Biochem. J., Biophys. J., Biopolymers, Chemistry & Biodiversity, FEBS Letters, J. Am. Chem. Soc., J. Biol. Chem., J. Biomol. NMR, J. Peptide Sci., Protein Pept. Letters, Proteomics и др.) и 3 статьи в сборниках научных работ. По результатам исследований получено 9 патентов на изобретение РФ, подано 2 заявки на выдачу патента РФ. В 2009 г. патент на изобретение РФ №2316595 «Способ получения антимикробного пептида ареницина» вошёл в число 100 лучших изобретений России и получил диплом Федеральной службы по интеллектуальной собственности, патентам и товарным знакам. По теме работы опубликовано также 82 тезиса докладов, в том числе 43 тезиса на международных конференциях и 39 тезисов на российских конференциях.


^ Личный вклад автора.

Автору принадлежит решающая роль в выборе направления и объектов исследований, разработке и проверке предложенных в работе экспериментальных подходов на всех этапах работ по выделению, изучению структуры, биотехнологическому получению аналогов и исследованию биологической активности природных пептидных антибиотиков - от постановки задачи и планирования экспериментов до анализа, обсуждения, обобщения и оформления полученных результатов. Весь экспериментальный материал получен при непосредственном участии автора и под его научным руководством, за исключением физико-химических исследований, выполненых в лаборатории биомолекулярной ЯМР-спектроскопии ИБХ РАН.


^ СОДЕРЖАНИЕ РАБОТЫ


1. Исследование новых антимикробных пептидов ареницинов из целомоцитов морского кольчатого червя Arenicola marina.

1.1. Определение первичной структуры ареницинов. Определение полных последовательностей кДНК, кодирующих предшественники ареницинов, и соответствующих им полных аминокислотных последовательностей препроареницинов.

Ареницины были выделены из целомоцитов морского кольчатого червя пескожила ^ Arenicola marina, который принадлежит к семейству Arenicolidae, отряду Drilomorpha, классу Polychaeta, типу Annelida, с помощью препаративного гель-электрофореза и обращенно-фазовой ВЭЖХ и предоставлены для исследований лабораторией общей патологии Института экспериментальной медицины РАМН (рук. д.б.н. В.Н.Кокряков).

С помощью масс-спектрометрического анализа на масс-спектрометре VISION 2000 (ThermoBioAnalysis) нами были выявлены две изоформы пептида, названные ареницином-1 и ареницином-2 и имеющие молекулярные массы 2758,3 Да и 2772,3 Да, соответственно, и установлены их первичные структуры. Одной из характеристик, положенных в основу современной классификации антимикробных пептидов, является наличие в их структуре внутримолекулярных дисульфидных связей, играющих важную роль в формировании и поддержании их пространственной структуры. Определение числа остатков цистеина проводилось путем их химической модификации с помощью 4-винилпиридина. Ареницины подвергали денатурации в гуанидинхлориде, после чего дисульфидные связи восстанавливали дитиотреитолом с последующим алкилированием 4-винилпиридином с образованием стабильных производных цистеина - S-пиридилэтилцистеинов. Масс-спектрометрический анализ полученных производных выявил молекулярные ионы с m/z 2970,3 для S-пиридилэтилированного ареницина-1 и m/z 2984,7 для S-пиридилэтилированного ареницина-2, что соответствует возрастанию молекулярной массы каждого пептида на 212 Да после модификации и свидетельствует о наличии в каждом пептиде двух остатков цистеина, образующих одну дисульфидную связь.

Для определения N-концевой аминокислотной последовательности выделенных антибиотиков применяли автоматическое микросеквенирование на приборе Procise 491 cLC Protein Sequencing System (Applied Biosystems, США). Идентификацию фенилтиогидантоин-производных аминокислот проводили на анализаторе 120A PTH Analyzer (Applied Biosystems, США). В результате автоматического микросеквенирования ареницинов и их S-пиридилэтилированных производных были установлены частичные (95%) аминокислотные последовательности обеих изоформ ареницина, включая локализацию остатка цистина.

Для установления полной первичной структуры предшественников ареницинов была выделена суммарная РНК из целомоцитов ^ Arenicola marina с использованием колонки Spin (Promega, США). Определение структуры генов, кодирующих ареницины, проводили путем обратной транскрипции и амплификации с помощью набора реактивов SMART* RACE** cDNA Amplification Kit (Clontech; *^ SMART - Switching Mechanism at 5’ end of RNA Transcript; **RACE – Rapid Amplification of cDNA Ends). RACE представляет собой метод быстрой амплификации концевых последовательностей кДНК с помощью полимеразной цепной реакции. Методом RACE были амплифицированы сначала 3’-концевые, а затем 5’-концевые области транскриптов, кодирующих ареницины. Структуры ген-специфических праймеров для 3’-RACE выбирались на основании данных по аминокислотной последовательности зрелых пептидов с учетом вырожденности генетического кода и данных по частоте использования кодонов у Arenicola marina и филогенетически близких организмов. Продукты ПЦР были клонированы и просеквенированы. Анализ установленной нуклеотидной последовательности позволил определить полную первичную структуру предшественников ареницинов.

Структура полноразмерной кДНК (около 1300 п.о.) предшественника ареницина-1 была получена путем сопоставления результатов секвенирования 3’- и 5’-концевых фрагментов (Error: Reference source not found). Структуры кДНК были зарегистрированы в банке данных GenBank под номерами AY684856 и AY684857.



В обоих случаях анализ нуклеотидной последовательности показал наличие открытой рамки считывания, кодирующей предшественник ареницина размером 202 аминокислотных остатка (регистрационные номера в банке данных SwissProt – Q5SC60 и Q5SC59). Участок, соответствующий зрелому пептиду (21 аминокислотный остаток), расположен в С-концевой области предшественника.

С помощью компьютерного анализа с использованием алгоритма SignalP 3.0 (http://www.cbs.dtu.dk/services/SignalP/) выявлена вероятная N-концевая сигнальная последовательность белка (25 аминокислотных остатков), необходимая для его транспортировки в эндоплазматический ретикулум. Длина фрагмента между сигнальным и зрелым пептидами составила 156 аминокислотных остатков. На границе между продоменом и зрелым пептидом выявлен дипептид из катионных остатков (Lys-Arg), что указывает на возможное участие протеиназы из семейства фурина в процессинге проареницинов.

При сравнении кДНК двух изоформ ареницина были обнаружены нуклеотидные замены, в отдельных случаях приводящие к аминокислотным заменам (Рис. 2). Секвенирование клонов, содержащих 5’-концевые области кДНК, показало, что некоторые из них кодируют цистеин в положении 10 сигнального пептида, в то время как другие, включая клон, содержащий последовательность ареницина-2, кодируют тирозин. Наблюдаемая замена может свидетельствовать о наличии двух различных копий гена ареницина-1 в геноме Arenicola marina.

Зрелые ареницин-1 и ареницин-2 содержат по 21 аминокислотному остатку каждый и имеют расчетные молекулярные массы 2758,3 Да и 2772,3 Да, совпадение которых с экспериментальными значениями масс молекулярных ионов говорит об отсутствии посттрансляционных модификаций у этих пептидов.


1 С 50

препроареницин-1 MTSTQSVAVYATLILAIFCVNDIHCDPIAEARAAAFGEREARSDGEWKQF

препроареницин-2 MTSTQSVAVYATLILAIFCFNDIHCDPIAEARAAAFGEREARSAGEWKQF


51 100

DVNGEKIEVNEQENREIIRQAGGDGVEGSVMVIDHAKGLISWSIPRAGEC

DVNGEKVEVNEQENREIIRQAGGDGVEGSVMVIDHAKGLIIWSIPRAGEC


101 150

YLIGGVDKQLPDAQELLHYFQSAQGSADGEGVESALDYVKAEDRPVTDLN

YLIGGVDKQLPDAQELLHYFRSAQGSADGEGVQSALDYVKAEDRPVTDLN


151 202

LLAPEVREACQGKSVYWLEKSSGDNNEPEKRRWCVYAYVRVRGVLVRYRRCW

LLAPEVREACQGKSVYWLEKSSGDNNEPEKRRWCVYAYVRIRGVLVRYRRCW


Рис. 2. Сравнение аминокислотных последовательностей предшественников ареницина-1 и ареницина-2. Темно-серым цветом выделен сигнальный пептид, светло-серым – продомен, черным – зрелый пептид. В рамки заключены аминокислотные замены. Один из вариантов препроареницина-1 содержит остаток цистеина в положении 10 сигнального пептида.


C-Концевая карбоксильная группа ареницинов не амидирована; данная модификация возможна лишь при наличии в структуре предшественника остатка глицина, следующего непосредственно за концевым остатком зрелого пептида. Более половины остатков, входящих в состав зрелых ареницинов, имеют ярко выраженные гидрофобные свойства. Катионный характер молекулы обусловлен присутствием 6 остатков аргинина. Установленная аминокислотная последовательность не имеет гомологии с известными представителями этой группы молекул. Уникальная особенность ареницинов состоит в формировании ими больших 18-членных циклов, замкнутых дисульфидной связью.

Размеры продомена препроареницинов значительно превышают длину соответствующих участков, встречающихся в предшественниках других АМП. Поиск в базах данных по аминокислотным и нуклеотидным последовательностям (http://www.ncbi.nlm.nih.gov/BLAST) позволил обнаружить сходство продомена предшественника ареницина с продоменами предшественников хондромодулинов – факторов роста и дифференцировки хрящевой ткани и ингибиторов ангиогенеза у различных видов позвоночных. Степень гомологии достигает 25% идентичных или 46% эквивалентных остатков. При этом для выравнивания последовательностей длиной около 130 аминокислотных остатков достаточно введения всего нескольких разрывов (рис. 3). С помощью анализа, основанного на сравнении установленной последовательности с моделями Маркова, построенными для известных консервативных доменов (http://smart.embl-heidelberg.de), была выявлена принадлежность препроареницинов к группе белков, содержащих домен BRICHOS, идентифицированный в ряде функционально несвязанных друг с другом белков человека, ассоциированных с различными заболеваниями. К ним относятся хондромодулины, участвующие в патогенезе хондросаркомы, белки семейства BRI, мутации которых наблюдаются при наследственной деменции, гастрокин-1 (белок CA11), пониженная экспрессия которого отмечается при раке желудка, сурфактантный белок SP-C, снижение уровня экспрессии которого сопряжено с расстройствами дыхательной системы. На сегодняшний день домен BRICHOS обнаружен в 12 различных семействах белков. О древнем происхождении домена BRICHOS свидетельствует наличие гомологичных ему участков в геномных последовательностях иглокожих, круглых червей, насекомых и ланцетников. Кроме того, наблюдается сходство в механизмах процессинга этих белков. Большинство из них являются секретируемыми белками, расщепляемыми по сайту из сдвоенных катионных остатков и несущим склонный к агрегации С-концевой фрагмент, стабилизированный дисульфидной связью. Ранее было высказано предположение о том, что домен BRICHOS участвует в процессинге содержащих его белков. В настоящее время появились данные об участии домена BRICHOS в процессе биосинтеза ряда β-структурных пептидов и белков в качестве шаперона, предотвращающего образование амилоидных структур.

Определенная нами полная структура зрелых ареницинов и генов их предшественников позволяет сделать вывод о выявлении нами оригинальных пептидов, не принадлежащих ни к одному из известных ранее классов антимикробных пептидов эндогенного происхождения. Заявляемые пептиды принадлежат к новому структурному классу пептидных антибиотиков, что послужило основанием для получения патента на изобретение Российской Федерации. Ареницины содержат 21 аминокислотный остаток и одну дисульфидную связь, формирующую цикл, состоящий из 18 аминокислотных остатков.




^ 1.2. Гетерологичная экспрессия и очистка ареницина-2.

В ходе выполнения данной работы создана патентно чистая технология гетерологичной экспрессии ареницинов. Получены патенты на изобретение «Рекомбинантная плазмидная ДНК pE-His8-TrxL-Ar2, кодирующая гибридный белок, содержащий антимикробный пептид ареницин морского кольчатого червя Arenicola marina, и штамм Escherichia coli BL21(DE3)/pE-His8-TrxL-Ar2 - продуцент гибридного белка, содержащего ареницин» и «Способ получения антимикробного пептида ареницина». Первое изобретение позволило решить задачу конструирования плазмиды для получения ареницина в составе гибридного белка, а также задачу создания высокопродуктивного штамма-продуцента данного гибридного белка. Поставленная задача была решена за счет конструирования рекомбинантной плазмидной ДНК pE-His8-TrxL-Ar2 размером 4059 п.о., кодирующей гибридный белок His8-TrxL-Ar2, содержащий гистидиновый октамер, модифицированный тиоредоксин А (M37L) и искомый антимикробный пептид ареницин (рис. 4), а также за счет создания штамма Escherichia coli BL21(DE3)/pE-His8-TrxL-Ar2 – продуцента гибридного белка, содержащего антимикробный пептид ареницин. Введение остатка метионина непосредственно перед N концевым остатком рекомбинантного ареницина обеспечило возможность избирательного химического расщепления полипептидной цепи бромцианом с высвобождением целевого пептида, не содержащего каких-либо дополнительных

аминокислотных остатков по сравнению с природным ареницином. Использование тиоредоксина А в качестве партнера для рекомбинантной экспрессии позволило нейтрализовать токсичность антимикробного пептида для штамма-продуцента и благодаря этому достичь высоких выходов гибридного белка. Преимущество замены лейцином остатка метионина в положении 37 природного тиоредоксина А, а также использования плазмиды pET20b(+) в качестве основы для создания pE-His8-TrxL-Ar2 состоит в уменьшении числа фрагментов, получаемых в результате расщепления гибридного белка бромцианом. Расщепление гибридного белка His8-TrxL-Ar2 бромцианом привело к образованию всего одного побочного продукта, значительно отличающегося по молекулярной массе и физико-химическим свойствам от целевого пептида, что облегчило его выделение. Наличие гистидинового октамера в N-концевом участке экспрессируемой последовательности обеспечило возможность аффинной очистки гибридного белка His8-TrxL-Ar2 методом металло-хелатной хроматографии. Для биосинтеза рекомбинантного белка применялись оптимальные регуляторные элементы, контролирующие его экспрессию. Конструирование нового гена, кодирующего гибридный белок His8-TrxL-Ar2, осуществляли на основе плазмиды pET20b(+). Искусственный ген, кодирующий гистидиновый октамер, модифицированный тиоредоксин А (M37L) и ареницин, фланкированный сайтами рестриктаз BglII и XhoI, был получен химическим синтезом набора олигонуклеотидных фрагментов с последующей их сборкой и амплификацией при помощи полимеразной цепной реакции (ПЦР). Перед лигированием для получения липких концов продукт амплификации и векторную плазмиду обрабатывали рестриктазами BglII и XhoI. Лигазную смесь использовали для трансформации компетентных клеток E.coli DH10B.



Рис. 4. Физическая карта рекомбинантной плазмиды pET-His8-TrxL-Ar2 и участок, кодирующий гибридный белок. ColE1 origin – участок инициации репликации плазмиды pBR322; f1 origin – участок инициации репликации бактериофага f1; bla – ген устойчивости к β-лактамным антибиотикам; lacI – ген lac-ингибитора; T7lac promoter – промотор транскрипции бактериофага Т7 с lac-оператором; T7 terminator – терминатор транскрипции; His8-TrxL-Ar2 – ген гибридного белка, содержащего ареницин-2. Указаны размеры гибридного белка в аминокислотных остатках, его молекулярная масса, порядок дисульфидных связей и сайт расщепления бромцианом.


Отбор положительных клонов проводили при помощи ПЦР с использованием специфических праймеров и последующим рестриктным анализом выделенной плазмидной ДНК. Структуру гена, кодирующего гибридный белок, содержащий ареницин, определяли секвенированием по методу Сэнгера. Для получения штамма-продуцента гибридного белка His8-TrxL-Ar2 препаратом плазмидной ДНК pE-His8-TrxL-Ar2 трансформировали компетентные клетки E. coli BL21(DE3) и проводили отбор клонов, обладающих способностью экспрессировать рекомбинантный белок. Преимущества запатентованного штамма E.coli BL21(DE3) заключаются в использовании бактерий с фенотипом Lon OmpT, что исключает возможность протеолитического расщепления синтезируемого de novo рекомбинантного белка и загрязнения препарата наиболее активными протеазами E. coli. У ровень экспрессии рекомбинантных белков контролировали с помощью электрофореза в полиакриамидном геле. Было показано, что клетки E.coli BL21(DE3)/pE-His8-TrxL-Ar2 являются суперпродуцентом ареницина. При индукции изопропилтио-β-D-галактозидом происходит эффективный биосинтез гибридного белка His8-TrxL-Ar2, содержащего ареницин, который накапливается в клетках в количестве 20–25% от суммарного белка бактерии. Задача получения рекомбинантного ареницина, полностью идентичного природному пептиду, была решена путем культивирования штамма-продуцента, индукции синтеза рекомбинантного белка, разрушения клеток, отделения нерастворимой фракции клеточного белка, очистки гибридного белка His8-TrxL-Ar2 с помощью металло-хелатной хроматографии, его солюбилизации и расщепления бромцианом в кислой среде по остатку метионина, разделения продуктов реакции и окончательной очистки ареницина методом обращенно-фазовой ВЭЖХ. Увеличение выхода рекомбинантного белка было достигнуто с помощью принудительной аэрации культуральной жидкости и использования обогащенных питательных сред (с добавлением глюкозы). Идентичность рекомбинантного ареницина природному пептиду устанавливали методами электрофореза в полиакриамидном геле, масс-спектрометрии, автоматическим секвенированием N-концевой аминокислотной последовательности по методу Эдмана. Выход продукта составил около 5 мг/л культуры.


^ 1.3. Антимикробная активность ареницина.

Антимикробная активность природного и рекомбинантного ареницина определялась методом радиальной диффузии пептидов в агарозном геле с тест-культурой микроорганизма и методом двукратных серийных разведений антибиотика в жидкой питательной среде LB. Для определения антимикробной активности использовали культуры следующих микроорганизмов: грам-отрицательные бактерии Escherichia coli ML-35p и Agrobacterium tumefaciens A281; грам-положительные бактерии Listeria monoсytogenes EGD, Staphylococcus aureus 209p, Bacillus megaterium VKM41, Micrococcus luteus B1314, устойчивый к метициллину штамм Staphylococcus aureus ATCC 33591 (MRSA), дрожжеподобный низший гриб Candida albicans 820; фитопатогенные грибы класса аскомицетов Fusarium solani VKM F-142, Fusarium oxysporum ТСХА-4, Alternaria alternata VKM F-3047, Aspergillus niger VKM F-2259, Aspergillus versicolor VKM F-1114, Neurospora crassa VKM F-184. Результаты тестирования представлены в таблице 1. Минимальные ингибирующие концентрации (МИК) определяли в трёх независимых экспериментах. МИК природного и рекомбинантного ареницинов достоверно не различаются. Показано, что генно-инженерные ареницины проявляют микробицидную активность в отношение всех иссследованных тест-микроорганизмов. Установлено, что данные пептиды обладают широким спектром антимикробного действия и эффективно ингибируют рост грам-положительных и грам-отрицательных бактерий, а также дрожжеподобных и фитопатогенных грибов. Ареницины имеют сходную, а в некоторых случаях и более высокую антибактериальную активность по сравнению с одним из наиболее хорошо изученных антимикробных пептидов - протегрином 1. Наибольшей активностью ареницины обладают в отношение грам-положительных бактерий, и МИК для таких культур, как Listeria monocytogenes EGD, Bacillus megaterium VKM41 и Micrococcus luteus B1314 находится в диапазоне концентраций 0,6-2,6 мкг/мл. Наиболее чувствительной к данным антибиотикам грам-положительной культурой является Listeria monocytogenes EGD. Ареницины также эффективно подавляют рост грам-отрицательных бактерий Escherichia coli ML-35p и Agrobacterium tumefaciens 281, а также дрожжеподобного гриба Candida albicans 820. МИК для этих культур не превышает 5 мкг/мл. Ареницины ингибируют прорастание спор и созревание всех исследованных фитопатогенных грибов. Наиболее чувствительными к ареницинам грибковыми культурами являются Neurospora crassa VKM F-184, Aspergillus versicolor VKM F-1114 и Botrytis cinerea VKM F-85. Для этих культур МИК составляет не более 25 мкг/мл. Менее чувствительным к ареницинам фитопатогеном являются Fusarium solani VKM F-142, для которого МИК не превышает 50 мкг/мл. Наиболее устойчивыми к действию тестируемых антибиотиков являются Alternaria alternata VKM F-3047, Aspergillus niger VKM F-2259 и Fusarium oxysporum ТСХА-4, для которых МИК90 составляет 100 и более мкг/мл. Необходимо отметить, что сравнение противогрибковой активности ареницинов показывает, что ареницин-более эффективно, чем ареницин-2, подавляет рост Fusarium oxysporum и Aspergillus versicolor. В тоже время, для ингибирования роста Neurospora crassa и Fusarium solani требуются меньшие концентрации ареницина-2.


Таблица 1. Антимикробная активность природного и рекомбинантного ареницина.



Тест-культуры


Ар-2 природный

Ар-2 рекомбинантный

 

МИК (мкг/мл)*

Грам-положительные бактерии

^ Listeria monocytogenes EGD

0,6

0,6

Staphylococcus aureus АTTC 33591 (MRSA)

н.о.

2,6

^ Bacillus megaterium VKM41

н.о.

2,6

Micrococcus luteus B1314

н.о.

2,6

Грам-отрицательные бактерии

^ Escherichia coli ML-35p

4,0

4,0

Agrobacterium tumefaciens A281

н.о.

5,0

Грибы

^ Candida albicans 820

4,5

4,5

Alternaria alternata VKM F-2259

н.о.

100,0

^ Botrytis cirenea VKM F-85

н.о.

12,5

Neurospora crassa VKM F-184

н.о.

12,5

^ Fusarium oxysporum ТСХА-4

н.о.

100,0

Fusarium solani VKM F-142

н.о.

25,0

^ Aspergillus versicolor VKM F-1114

н.о.

25,0

Aspergillus niger VKM F-2259

н.о.

100,0


^ 1.4. Биотехнологическое получение аналогов ареницина, меченных стабильными изотопами 13C и 15N.

Экспрессия меченых аналогов ареницина проводилась с использованием штамма E.coli BL21(DE3), трансформированного плазмидой pET-His8-TrxL-Ar2. Для наработки плазмидной ДНК использовался штамм E. coli DH-10B (RecA–). Полученными препаратами плазмиды были трансформированы компетентные клетки E. coli BL21 (DE3), приготовленные стандартным кальциевым методом. Трансформанты выращивались на чашках с агаризованной средой LB, содержащей ампициллин. Для подавления базальной экспрессии гибридного белка в питательную среду добавлялось 0,5% глюкозы. Клетки клонов, отобранных для экспрессии, выращивались в 100 мл жидкой среды LB, содержащей 100 мкг/мл ампициллина и 0,5% глюкозы при 37ºС и 250 rpm в течение 16 ч. По окончании инкубации оптическая плотность клеточной культуры OD600 составляла 2,0-3,0 ед. Клеточную массу собирали центрифугированием при 2000 rpm и трижды отмывали физиологическим раствором NaCl от остатков богатой питательной среды. Для препаративной экспрессии ареницина, меченного стабильными изотопами, полученной клеточной массой засевали 1–2 л бедной питательной среды M9, включающей 13C6-меченую глюкозу и/или 15N-меченый хлорид аммония. Экспрессия проводилась при температуре 30ºС и индукции ИПТГ в концентрации 0,2-0,5 мМ в течение 18 ч. Клеточный осадок получали центрифугированием, после чего клетки ресуспендировали и подвергали обработке ультразвуком. Нерастворимую фракцию клеточного белка (тельца включения) отделяли центрифугированием. Осадок растворяли в фосфатном буфере (pH 7,7), содержащем 6М гуанидин-гидрохлорид и 10 мМ имидазола. Раствор подвергали металло-хелатной очистке на Ni-NTA агарозе в указанном буфере, элюируя белок повышением концентрации имидазола до 500 мМ. Компоненты буфера удаляли с помощью диализа против воды через мембрану с размером пор 14 кДа. Выпавший в осадок гибридный белок высушивали, взвешивали и перерастворяли в 80% растворе ТФУ в концентрации 5%. Целевой пептид получали в результате расщепления гибридного белка бромцианом при 100-кратном молярном избытке последнего в течение 16 ч. Летучие компоненты реакционной смеси удаляли путем упаривания в вакууме. Тонкая очистка ареницина осуществлялась с помощью обращенно-фазовой ВЭЖХ в градиенте концентрации ацетонитрила. Идентификацию целевых пептидов и оценку чистоты полученных препаратов проводили с помощью электрофореза в полиакриламидном геле и MALDI-TOF масс-спектрометрии. Полученные экспериментально значения молекулярных масс 15N-меченого и 13C,15N-меченого ареницина-2 с высокой точностью совпадали с расчетными, составляющими 2812,5 и 2939,5 Да, соответственно. 15N- и 13C,15N-Меченые аналоги ареницина-2 были охарактеризованы методом ЯМР-спектроскопии. Было установлено, что препараты имеют высокую степень обогащения стабильными изотопами (более 98% для 15N и более 95% для 13С). Разработанная схема гетерологичной экспрессии и очистки аналогов ареницина, меченных стабильными изотопами, позволила получить достаточные количества этих пептидов для проведения их дальнейших исследований методом ЯМР-спектроскопии. Использование изотопно-меченых аналогов ареницина позволило детально исследовать динамику основной и боковых цепей пептида в водном окружении.


^ 1.5. Исследование физико-химических свойств ареницина.

Физико-химическое исследование ареницина проводилось в лаборатории биомолекулярной ЯМР-спектроскопии ИБХ РАН (с.н.с. З.О.Шенкарёв, рук. лаб. проф. А.С.Арсеньев). Используя рекомбинантные аналоги ареницина, методами ЯМР-спектроскопии была определена пространственная структура ареницина-2 в водном растворе (рис. 5). Было показано, что молекула ареницина-2 представляет собой протяженную β-шпильку, на конце которой находится β-поворот I’ типа (остатки Ile10-Val13). Методами 1H,13C,15N-ЯМР-спектроскопии была исследована пространственная структура ареницина в растворе мицелл DPC, моделирующих мембранное окружение. Показано, что пептид формирует параллельные симметричные димеры путем ассоциации N-концевых β-тяжей (CN↑↑NC) (рис. 6). Установлено, что пептид при взаимодействии с мицеллой DPC и димеризации сохраняет структуру β-шпильки, однако ее скрученность значительно уменьшается и тип β-поворота изменяется с I’ на IV.





Рис. 5. Пространственная структура ареницина-2 в водном растворе.





Рис. 6. Пространственная структура димера ареницина в растворе мицелл DPC.


Методом КД-спектроскопии также было показано, что при связывании с поверхностью мицелл детергентов (DPC, SDS) происходит изменение конформации пептида. Используя метод КД-спектроскопии, было проведено исследование взаимодействия ареницина-2 с липидными везикулами различного состава. Для исследования были использованы как нейтральные моноламелярные липосомы (POPC), моделирующие мембраны эукариотических клеток, так и отрицательно заряженные липосомы (POPE/POPG), моделирующие мембраны бактериальных клеток. Было установлено, что ареницин-2 эффективно взаимодействует с заряженными мембранами, но практически не взаимодействует с нейтральными мембранами.

Полученные данные позволяют объяснить специфичность антимикробного действия ареницинов и дают основания для предположения, что основной мишенью для действия этих пептидов является клеточная мембрана.


^ 1.6. Модель антибиотического действия ареницина.

На основании полученных результатов совместно с лабораторией биомолекулярной ЯМР-спектроскопии предложена модель действия пептида, в рамках которой антибиотическое действие ареницина опосредовано образованием олигомерных β-структурных пор в мембране клетки-мишени. Согласно предложенной модели механизм действия пептида включает несколько этапов.

  1. Молекулы ареницина, несущие положительный заряд (+6), в конформации скрученной бета-шпильки приближаются к поверхности мембраны клетки. При присоединении пептида к поверхности мембраны происходит значительное уменьшение скрученности бета-шпильки пептида с образованием димеров.

  2. Димеры пептида претерпевают дальнейшую олигомеризацию на поверхности мембраны клетки с участием отрицательно заряженных липидных головок. Образуется так называемая «ковровая» структура. При увеличении концентрации пептидов в наружном монослое мембраны часть пептидов переходит в трансмембранное положение (длина бета-шпильки ареницина > 30 ангстрем).

  3. Трансмембранные олигомеры ареницина образуют пептид-липидные («тороидальные») поры в мембране. В образовании каждой поры участвуют как димеры пептида, так и головки отрицательно заряженных липидов, встроенные между ними. Полярные группы боковых цепей ареницина и головки липидов выстилают внутренность поры, а гидрофобные участки димеров контактируют с липидными хвостами окружающей мембраны. Образование «тороидальных» пор ведет к лизису и гибели бактериальной клетки.


^ 2. Исследование антимикробного пептида аурелина из мезоглеи сцифоидной медузы Aurelia aurita.

2.1. Определение первичной структуры аурелина. Определение полной последовательности кДНК, кодирующей предшественник аурелина, и соответствующей ей полной аминокислотной последовательности препроаурелина.

Новый антимикробный пептид аурелин с молекулярной массой 4296,95 Да был выделен из мезоглеи медузы ^ Aurelia aurita [тип – кишечнополостные (Cnidaria), класс – сцифоидные (Scyphozoa)] с помощью препаративного гель-электрофореза и обращенно-фазовой ВЭЖХ и предоставлен для исследований лабораторией общей патологии Института экспериментальной медицины РАМН (рук. д.б.н. В.Н.Крокряков).

Определение числа остатков цистеина проводилось путем их химической модификации с помощью 4-винилпиридина по методике, описанной в разделе 1.1. Масс-спектрометрический анализ полученного S-пиридилэтилированного производного аурелина выявил молекулярный ион с m/z 4926,15, соответствующим возрастанию молекулярной массы на 629,2 Да, что свидетельствует о наличии в аурелине шести остатков цистеина, образующих 3 дисульфидных связи. Для определения N-концевой аминокислотной последовательности аруелина применяли автоматическое микросеквенирование на приборе Procise 491 cLC Protein Sequencing System (Applied Biosystems, США). Идентификацию фенилтиогидантоин-производных аминокислот проводили на анализаторе 120A PTH Analyzer (Applied Biosystems, США). В результате автоматического микросеквенирования аурелина и его S-пиридилэтилированного производного была установлена его частичная аминокислотная последовательность (35 остатков), включая локализацую остатков цистеина.

Для установления полной первичной структуры предшественника аурелина была выделена суммарная РНК из мезоглеи медузы ^ Aurelia aurita с использованием колонки Spin (Promega, США). Амплификация 3’-концевого участка кДНК аурелина по указанной выше методике не позволяла получить искомый фрагмент в одну стадию ОТ-ПЦР. Вероятной причиной этого послужило низкое содержание соответствующей мРНК в тканях медузы. Продукты RACE были успешно реамплифицированы с внутренними ген-специфическими праймерами (semi-nested PCR). Секвенирование клонированных фрагментов длиной около 300 п.о. показало, что они содержали последовательность, кодирующую C-концевую область зрелого аурелина, и область 3’-UTR.

Дальнейшие эксперименты по амплификации и секвенированию 5’-концевой области кДНК позволили установить полную структуру транскрипта длиной около 500 п.о. (рис. 7). Анализ нуклеотидной последовательности показал наличие открытой рамки считывания, кодирующей предшественник антимикробного пептида аурелина, состоящий из 84 аминокислотных остатков. Зрелый пептид длиной 40 аминокислотных остатков локализован в C-концевой области предшественника непосредственно за последовательностью Arg-Ser-Arg-Arg, представляющей собой типичный сайт протеолиза для конвертаз семейства фурина. С помощью программы SignalP 3.0 была обнаружена вероятная N-концевая сигнальная последовательность, отщепляемая при гидролизе связи Ala22 – Glu23.

Результаты секвенирования нуклеотидной последовательности кДНК подтвердили наличие в структуре пептида шести остатков цистеина. Уникальный порядок расположения остатков цистеина в аурелине отличает его как от дефенсинов, так и от всех других семейств цистеин-содержащих АМП (табл. 2). Его ближайшими гомологами в настоящее время можно считать группу токсинов из яда морских анемон (класс Anthozoa, тип Coelenterata), блокирующих калий-селективные каналы нервных клеток. Перечень структур, гомологичных аурелину, не ограничивается токсинами морских анемон. Близкий по структуре гексацистеиновый мотив с неизвестной функцией, обозначаемый в разных источниках как домен NC6, SXC, Tox1 или ShKT, был идентифицирован в ряде белков позвоночных и беспозвоночных животных. Мотив присутствует главным образом в секретируемых муцин-подобных гликопротеинах и ферментах (астацин-подобных металлопротеиназах, тирозиназах, миелопероксидазах).






Детальный анализ последовательности аурелина показал наличие в ней консервативных остатков, играющих ключевую роль в функционировании ShK-подобных токсинов. Способность токсинов с принципиально различающейся укладкой цепи избирательно блокировать ионные каналы одного и того же типа зависит от присутствия и пространственного расположения ограниченного набора молекулярных детерминант. Сканирование аланином последовательностей ShK и BgK позволило определить сайты связывания этих токсинов с потенциал-зависимыми калиевыми каналами и показало, что доминирующий вклад в это взаимодействие вносит функциональная диада Lys-Tyr, расположенная на участке C4–C5. В структуре аурелина сохраняется главный компонент диады – Lys, однако в роли его партнера выступает не Tyr, а остаток Leu (Error: Reference source not found8). Похожая картина наблюдается и у метридина, токсина из анемоны Metridium senile, в молекуле которого функцию второго остатка выполняет Val. Известно, что аминокислотная замена Tyr/Leu в диаде не приводит к потере блокирующей активности токсинов.



Перечень структур, гомологичных аурелину, не ограничивается токсинами морских анемон. Близкий по структуре гексацистеиновый мотив, обозначаемый в разных источниках как домен NC6, SXC, Tox1 или ShKT, был идентифицирован в ряде белков беспозвоночных и позвоночных животных. Мотив присутствует главным образом в секретируемых муцин-подобных гликопротеинах и ферментах (астацин-подобных металлопротеиназах, тирозиназах, миелопероксидазах). Его функция в составе крупных молекул неясна, но по аналогии с EGF-доменом предполагается, что он может участвовать во взаимодействиях внеклеточных белков и играет роль лиганда в опосредованной мембранными рецепторами передаче сигналов внутрь клетки. Наиболее консервативной областью домена является фрагмент между C4 и C6, включающий диаду Lys-Thr непосредственно перед C5. Остаток Lys из этой диады участвует в стабилизации домена, электростатически взаимодействуя с консервативным остатком Asp, находящимся в положении –2 относительно C1 (рис. 8).

Препроаурелин имеет типичное для предшественников многих АМП строение: вслед за сигнальным пептидом, несущим положительный заряд на N-конце, следуют анионный продомен и зрелый катионный пептид, отщепляемый по сайту из сдвоенных основных остатков (рис. 9). Сходными структурными чертами обладает предшественник HmK – единственного токсина этого семейства, последовательность кДНК которого была депонирована в GenBank. Гомология предшественников токсина HmK и аурелина наблюдается лишь в области зрелых пептидов, в то время как сходство сигнальных участков и продоменов ограничивается одинаковым распределением заряженных и гидрофобных остатков.




Структурное сходство аурелина с пептидами из морских анемон наводит на мысль о вероятной способности этого пептида блокировать ионные каналы. В настоящее время известен ряд фактов гомологии и функционального сходства АМП и пептидных токсинов. Наиболее убедительным объяснением такого сходства служит гипотеза о дивергентной эволюции этих молекул. Существование общих эволюционных предшественников у представителей именно этих классов пептидов представляется биологически целесообразным. Несмотря на разную направленность действия, условия их функционирования предъявляют сходные требования к структуре и физико-химическим свойствам. Независимо от степени эволюционного родства аурелина с нейротоксинами перспективы его использования в качестве антимикробного средства будут определятся селективностью его действия и наличием побочных эффектов, которые могут быть установлены только экспериментальным путем.
^

2.2 Гетерологичная экспрессия и очистка аурелина.


Штамм-продуцент гибридного белка His8-TrxL-Aur, содержащего последовательность целевого пептида аурелина, был получен путем трансформации препаратом векторной ДНК pET-His8-TrxL-Aur (рис. 10) компетентных клеток E. coli и отбора клонов, обладающих способностью экспрессировать рекомбинантный белок. В качестве родительского штамма для создания штамма-продуцента использовали E.coli BL21(DE3). Преимущество использования данного штамма в качестве основы для создания штамма-продуцента состоит в том, что BL21 (DE3) обладает фенотипом Lon OmpT, что исключает возможность протеолитического расщепления синтезируемого гибридного белка и загрязнения препарата наиболее активными протеазами E. coli. В хромосомную ДНК BL21(DE3) интегрирован ген Т7-РНК полимеразы, который совместно с Т7 промотором и Т7 терминатором в плазмиде pET-His8-TrxL-Aur обеспечивает продукцию гибридного белка клетками E. coli при индукции изопропилтио-β-D-галактозидом или лактозой. Базальная экспрессия (до момента добавления индуктора) Т7 РНК-полимеразы и гибридного белка His8-TrxL-Aur поддерживается на минимальном уровне благодаря наличию системы контроля на основе lac-операторов и генов lac-репрессора, присутствующих как в плазмиде pET-His8-TrxL-Aur, так и в хромосоме штамма-продуцента. продуцента. Препаратами плазмиды были трансформированы компетентные клетки E. coli BL21 (DE3), приготовленные стандартным кальциевым методом. Трансформанты выращивали при температуре 37ºС на чашках с агаризованной средой LB, содержащей 50 мкг/мл ампициллина. Для подавления базальной экспрессии гибридного белка в питательную среду добавляли 0,5 % глюкозы.

Препаративную экспрессию гибридного белка His8-TrxL-Aur проводили в 2 л колбах, заполненных культуральной средой на ¼ от полного объема, при температуре 30ºС. Индукцию осуществляли путем добавления изопропилтио-β-D-галактозида до концентрации 0,2 мМ. Плотность культуры (OD600) в момент добавления индуктора составляла 0,6, конечная плотность после инкубации в течение 4,5ч – 1,8.





Рис. 10. Физическая карта рекомбинантной плазмиды pET-His8-TrxL-Aur. ColE1 origin – участок инициации репликации плазмиды; f1 origin – участок инициации репликации бактериофага f1; bla – ген устойчивости к β-лактамным антибиотикам; lac I – ген lac-ингибитора; T7lac promoter – промотор транскрипции бактериофага Т7 с lac-оператором; T7 terminator – терминатор транскрипции; His8-TrxL-Aur – ген гибридного белка, содержащего аурелин.


Клеточный осадок получали центрифугированием, ресуспендировали и подвергали ультразвуковой обработке. Растворимую фракцию клеточного белка получали центрифугированием и разделяли с помощью металлохелатной хроматографии на Ni-NTA. Целевой пептид получали в результате расщепления гибридного белка бромцианом. Продукты расщепления повторно пропускали через металлохелатную колонку. Целевой пептид подвергали тонкой очистке методом обращенно-фазовой ВЭЖХ. Выход пептида в пересчете на 1л клеточной культуры составил 10мг. Идентичность рекомбинантного и природного аурелина устанавливали методами ПААГ-электрофореза в денатурирующих услових, МАЛДИ-времяпролетной масс-спектрометрии, автоматическим микросеквенированием N-концевой аминокислотной последовательности по методу Эдмана, тестированием антимикробной активности. Полученный препарат антимикробного пептида аурелина был проанализирован методом 1H-ЯМР спектроскопии. Анализ спектров ЯМР позволил установить, что пептид имеет жесткую пространственную структуру, и чистота препаратов рекомбинантного аурелина составляет не менее 98%.


^ 2.3. Антимикробная активность аурелина.

Антимикробную активность очищенного рекомбинантного и природного пептида определяли методом радиальной диффузии пептида в агарозном геле в отношение тест-культур бактерий: Bacillus megaterium VKM41, Staphylococcus aureus 209p, Micrococcus luteus B1314. Антимикробное действие пептида определяли по диаметру зон ингибирования роста тест-культуры. Результаты тестирования активности природного аурелина и пептида, полученного заявленным способом, представлены в таблице 3.


Таблица 3.

Антимикробная активность аурелина

Количество пептида

(мкг на лунку)

Диаметр зоны ингибирования роста тест-культуры в концентрациях 105 КОЕ/мл, мм (±0,5 мм)

^ Micrococcus luteus

Bacillus megaterium

Staphylococcus aureus

20,0

природный

10,0

12,0

4,0

Рекомбинантный

10,0

12,0

4,5

10,0

природный

6,5

11,0

3,5

Рекомбинантный

7,0

10,5

3,5

5,0

природный

6,5

10,0

3,0

Рекомбинантный

6,5

9,5

3,0


Показано, что очищенный аурелин в количестве 5 мкг/лунку проявляет антимикробную активность и ингибирует рост всех тестируемых бактерий. Наиболее чувствительной к пептиду культурой является B. megaterium. Активность рекомбинантного аурелина совпадает в пределах погрешности измерения с активностью природного пептида.


^ 2.4. Биотехнологическое получение аурелина, меченного стабильным изотопом 15N, для изучения его пространственной структуры методом гетероядерной 1H,15N- ЯМР-спектроскопии.

Аурелин, тотально меченный стабильным изотопом 15N, был получен по методике, описанной в разделе 1.4, с использованием плазмиды pE-His8-TrxL-Aur путем культивирования штамма E.coli BL21(DE3), трансформированного данной плазмидой, на бедной питательной среде М9, содержащей 15NH4Cl в качестве единственного источника азота. Используя образцы немеченого и 15N-меченого рекомбинантных аналогов аурелина, в лаборатории биомолекулярной ЯМР-спектроскопии ИБХ РАН (с.н.с., к.ф.-м.н. З.О.Шенкарев, рук. лаб. проф. А.С.Арсеньев) была изучена пространственная структура пептида в водном растворе. Показано, что пространственная структура аурелина представляет собой небольшую глобулу с двумя α-спиралями (остатки 10-14 и 24-32) и одной 310-спиралью (остатки 17-20). Структура стабилизирована тремя дисульфидными, 17 водородными связями между атомами основной цепи и одной водородной связью между HN Thr36 и Oδ1 Asp5 (рис. 11).





Рис. 11. Пространственная структура аурелина в воде. Красным цветом отмечены отрицательно заряженные остатки (Asp5, Glu13, Asp21), синим – положительно заряженные (Arg6, His8, His10, Lys16, Lys20, Arg24, Lys28, Arg30, Lys34, Lys35). Структура имеет в своем составе две α-спирали (остатки 10-14 и 24-32 – выделено красным) и одну 310-спираль (остатки 17-20 – выделено бирюзовым). Оранжевым цветом выделены дисульфидные связи (Cys3-Cys40, Cys12-Cys33, Cys19-Cys37). Водородная связь HN Thr36 – Oδ1 Asp5 обозначена пунктирной линией.


Анализ структуры аурелина указывает на амфифильность молекулы пептида. На поверхности наблюдается небольшой гидрофобный регион, образованный боковыми группами остатков Ile11, Phe15, Phe18. Наличием гидрофобного региона и окружающего его кольца положительно заряженных остатков может быть обусловлено сродство пептида к мембранам бактериальных клеток, содержащим анионные липиды. Высказано предположение о том, что мембранная активность аурелина лежит в основе его антимикробного действия.

^

3. Биотехнологическое получение буфорина-2 из пищеварительного тракта дальневосточной жабы Bufo bufo gargarisans.

3.1. Гетерологичная экспрессия и очистка буфорина-2.


Одним из перспективных для клинического применения АМП является буфорин-2, впервые выделенный из пищеварительного тракта дальневосточной жабы Bufo bufo gargarisans (Park C.B. et al., 1996). Буфорин-2 является фрагментом N-концевой части гистона H2A. Размер пептида составляет 21 аминокислотный остаток (trssraglqfpvgrvhrllrk, молекулярная масса 2435 Да). Пептид обладает широким спектром бактерицидного и фунгицидного действия, механизм которого, согласно последним исследованиям, состоит в образовании нестабильных тороидальных пор, быстрой транслокации антибиотика через мембрану и последующем связывании с нуклеиновыми кислотами. Минимальные ингибирующие концентрации буфорина-2 в отношение протестированных штаммов лежат в диапазоне 0,4–1,5 мкМ. В данных концентрациях пептид не проявляет гемолитической активности. Ранее было показано, что буфорин эффективен (особенно в комбинации с цефазолином) против метициллин-устойчивых штаммов Staphylococcus epidermidis, вызывающих серьезные инфекционные осложнения при трансплантации сосудов. Существующие системы экспрессии буфорина-2 в виде тандемных мультимеров (Lee J.H. et al., 2002) или в виде гибридного белка с фрагментом амидотрансферазы PurF (Pyo S.H. et al., 2004) позволяют получить буфорин-2, несущий дополнительный C-концевой остаток гомосерина или N-концевой остаток глицина.

В ходе выполнения данной работы созданы генетические конструкции для гетерологичной экспрессии буфорина-2, разработана эффективная технология получения и очистки генно-инженерного буфорина, полностью идентичного природному пептиду. Созданные конструкции pET-KSI-Buf2 и pET-KSI-MIS-Buf2 позволяют с помощью одной стадии хроматографической очистки получать полностью идентичный природному буфорин-2 в количестве 5–10 мг/л культуры. Сравнение суммарных лизатов индуцированных клеток E. coli BL-21(DE3) с помощью ПААГ-электрофореза показало приблизительно равное содержание гибридного белка при использовании обеих конструкций. Для наработки буфорина-2 была выбрана система BL-21(DE3)/pET-KSI-Buf2. Высокое содержание гибридного белка в клетке позволяло ограничить его очистку выделением нерастворимой фракции клеточного белка (телец включения). После расщепление гибридного белка бромцианом молекулрная масса полученного пептида, определенная методом МАЛДИ-времяпролетной масс-спектрометрии, соответствовала расчетной массе буфорина-2. Тонкая очистка буфорина-2 проводилась с помощью обращенно-фазовой ВЭЖХ.Чистота препарата подтверждалась с помощью МАЛДИ-времяпролетной масс-спектрометрии и электрофореза в ПААГ в присутствии SDS.




оставить комментарий
страница1/4
Дата23.01.2012
Размер1.38 Mb.
ТипДиссертация, Образовательные материалы
Добавить документ в свой блог или на сайт

страницы:   1   2   3   4
Ваша оценка этого документа будет первой.
Ваша оценка:
Разместите кнопку на своём сайте или блоге:
rudocs.exdat.com

Загрузка...
База данных защищена авторским правом ©exdat 2000-2017
При копировании материала укажите ссылку
обратиться к администрации
Анализ
Справочники
Сценарии
Рефераты
Курсовые работы
Авторефераты
Программы
Методички
Документы
Понятия

опубликовать
Загрузка...
Документы

Рейтинг@Mail.ru
наверх